Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTFAOU7)

• DTT Name: CD274 messenger RNA (CD274 mRNA)
• Synonyms: PD-L1; PDCD1 ligand 1; Programmed death ligand 1; hPD-L1; B7 homolog 1; B7-H1; DE AltName: CD_antigen=CD274
• Gene Name: CD274
• DTT Type: Clinical trial target; [1]
• UniProt ID: PD1L1_HUMAN
• TTD ID: T90457
• Sequence:
  MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
  DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
  ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
  TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
  LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET
• Function: Plays a critical role in induction and maintenance of immune tolerance to self. As a ligand for the inhibitory receptor PDCD1/PD-1, modulates the activation threshold of T-cells and limits T-cell effector response. Through a yet unknown activating receptor, may costimulate T-cell subsets that predominantly produce interleukin-10 (IL10).
• KEGG Pathway:
  Cell adhesion molecules (hsa04514)
  PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235)
• Reactome Pathway:
  STAT3 nuclear events downstream of ALK signaling (R-HSA-9701898)
  PD-1 signaling (R-HSA-389948)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
RG6084	DM9QNMB	Hepatitis B virus infection	1E51.0	Phase 1	[1]

References

• [1] Clinical pipeline report, company report or official report of Roche.