Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTFCW29)

• DTT Name: Leukocyte antigen CD37 (CD37)
• Synonyms: Tspan26; Tspan-26; Tetraspanin26; Tetraspanin-26
• Gene Name: CD37
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Tetraspanin
• UniProt ID: CD37_HUMAN
• TTD ID: T97111
• Sequence:
  MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKV
  LAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLR
  DVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCS
  CYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHN
  NLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARYR
• Function: extracellular exosome, immunological synapse, integral component of plasma membrane, membrane, cell surface receptor signaling pathway.
• KEGG Pathway: Hematopoietic cell lineage (hsa04640)

Molecular Interaction Atlas (MIA) of This DTT

6 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
BI-836826	DMWH7Z5	Diffuse large B-cell lymphoma	2A81	Phase 2	[2]
IMGN529	DMNJ491	Non-hodgkin lymphoma	2B33.5	Phase 2	[1]
Naratuximab emtansine	DMSWUNX	Diffuse large B-cell lymphoma	2A81	Phase 2	[3]
Otlertuzumab	DMAZIND	Chronic lymphocytic leukaemia	2A82.0	Phase 2	[4]
GEN3009	DMD8RLY	B-cell non-hodgkin lymphoma	2B33.5	Phase 1/2	[5]
TRU-016	DM9IQ4A	Chronic lymphocytic leukaemia	2A82.0	Phase 1/2	[6]

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
212Pb-labelled aCD37	DMLVADH	leukaemia	2A60-2B33	Preclinical	[7]

References

• [1] The CD37-targeted antibody-drug conjugate IMGN529 is highly active against human CLL and in a novel CD37 transgenic murine leukemia model. Leukemia. 2014 Jul;28(7):1501-10.
• [2] Anti-CD37 antibodies for chronic lymphocytic leukemia. Expert Opin Biol Ther. 2014 May;14(5):651-61.
• [3] Clinical pipeline report, company report or official report of Debiopharm.
• [4] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [5] Clinical pipeline report, company report or official report of AbbVie.
• [6] TRU-016, a humanized anti-CD37 IgG fusion protein for the potential treatment of B-cell malignancies. Curr Opin Investig Drugs. 2009 Dec;10(12):1383-90.
• [7] Radiopharmaceutical therapy in cancer: clinical advances and challenges. Nat Rev Drug Discov. 2020 Sep;19(9):589-608.