Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTFRES8)
DTT Name | Regulator of G-protein signaling 16 (RGS16) | ||||
---|---|---|---|---|---|
Synonyms | hRGS-r; Retinally abundant regulator of G-protein signaling; Retinal-specific RGS; RGSR; RGS-r; A28-RGS14P | ||||
Gene Name | RGS16 | ||||
DTT Type |
Patented-recorded target
|
[1] | |||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVL
GWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEE FICSEAPKEVNIDHETHELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDL AAQASAASATLSSCSLDEPSHT |
||||
Function |
Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Plays an important role in the phototransduction cascade by regulating the lifetime and effective concentration of activated transducin alpha. May regulate extra and intracellular mitogenic signals. Regulates G protein-coupled receptor signaling cascades.
|
||||
Reactome Pathway | |||||