Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTFX379)
DTT Name | Rhombotin-2 (LMO2) | ||||
---|---|---|---|---|---|
Synonyms | TTG2; T-cell translocation protein 2; RHOM2; RBTNL1; RBTN2; LMO-2; LIM-only protein 2; LIM-domain protein Lmo2; LIM domain only protein 2; Cysteine-rich protein TTG-2; Cysteine rich protein TTG-2 | ||||
Gene Name | LMO2 | ||||
DTT Type |
Literature-reported target
|
[1] | |||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLC
GCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECF KCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI |
||||
Function | Acts with LDB1 to maintain erythroid precursors in an immature state. Acts with TAL1/SCL to regulate red blood cell development. | ||||
KEGG Pathway | |||||
Reactome Pathway | |||||