Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTFY134)

• DTT Name: Keratinocyte growth factor (FGF7)
• Synonyms: KGF; Heparin-binding growth factor 7; HBGF-7; Fibroblast growth factor 7; FGF-7
• Gene Name: FGF7
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Growth factor
• UniProt ID: FGF7_HUMAN
• TTD ID: T19852
• Sequence:
  MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYME
  GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLA
  MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTK
  KEQKTAHFLPMAIT
• Function: Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation. Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation.
• KEGG Pathway:
  MAPK signaling pathway (hsa04010)
  Ras signaling pathway (hsa04014)
  Rap1 signaling pathway (hsa04015)
  Calcium signaling pathway (hsa04020)
  PI3K-Akt signaling pathway (hsa04151)
  Regulation of actin cytoskeleton (hsa04810)
  Pathways in cancer (hsa05200)
  Chemical carcinogenesis - receptor activation (hsa05207)
  Melanoma (hsa05218)
  Breast cancer (hsa05224)
  Gastric cancer (hsa05226)
• Reactome Pathway:
  PIP3 activates AKT signaling (R-HSA-1257604)
  FGFR2b ligand binding and activation (R-HSA-190377)
  Activated point mutants of FGFR2 (R-HSA-2033519)
  Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530)
  Phospholipase C-mediated cascade, FGFR2 (R-HSA-5654221)
  PI-3K cascade (R-HSA-5654695)
  SHC-mediated cascade (R-HSA-5654699)
  FRS-mediated FGFR2 signaling (R-HSA-5654700)
  Negative regulation of FGFR2 signaling (R-HSA-5654727)
  Signaling by FGFR2 in disease (R-HSA-5655253)
  RAF/MAP kinase cascade (R-HSA-5673001)
  PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558)
  PI3K Cascade (R-HSA-109704)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Keratinocyte growth factor	DMZK7N8	Solid tumour/cancer	2A00-2F9Z	Phase 1	[1]

References

• [1] Keratinocyte growth factor.Cell Biol Int.1995 May;19(5):399-411.