Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTGEM5Q)
DTT Name | Ciliary neurotrophic factor (CNTF) | ||||
---|---|---|---|---|---|
Synonyms | CNTF | ||||
Gene Name | CNTF | ||||
DTT Type |
Clinical trial target
|
[1] | |||
BioChemical Class |
Ciliary neurotrophic factor
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVAS
TDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFA YQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFIS SHQTGIPARGSHYIANNKKM |
||||
Function | CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. | ||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
Molecular Expression Atlas (MEA) of This DTT
References
1 | Reliability of maximal voluntary isometric contraction testing in a multicenter study of patients with amyotrophic lateral sclerosis. Syntex/Synergen Neuroscience Joint Venture rhCNTF ALS Study Group. Muscle Nerve. 1997 Jun;20(6):691-5. | ||||
---|---|---|---|---|---|
2 | Clinical pipeline report, company report or official report of Neurotech. | ||||