General Information of Drug Therapeutic Target (DTT) (ID: TTGER3L)

DTT Name Thyroid hormone receptor beta (THRB)
Synonyms c-erbA-beta; c-erbA-2; THR1; Nuclear receptor subfamily 1 group A member 2; NR1A2; ERBA2
Gene Name THRB
DTT Type
Successful target
[1]
BioChemical Class
Nuclear hormone receptor
UniProt ID
THB_HUMAN
TTD ID
T98933
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQ
TTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR
CITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVL
DDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWK
QKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED
QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL
SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Function High affinity receptor for thyroid hormones, including triiodothyronine and thyroxine. Nuclear hormone receptor that can act as a repressor or activator of transcription.
KEGG Pathway
Neuroactive ligand-receptor interaction (hsa04080 )
Thyroid hormone signaling pathway (hsa04919 )
Reactome Pathway
Nuclear Receptor transcription pathway (R-HSA-383280 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
1 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Dextrothyroxine Sodium DMBVEC7 High blood cholesterol level 5C80.00 Approved [1]
------------------------------------------------------------------------------------
8 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
BCT303 DMUFY4K Hypothyroidism 5A00 Phase 2 [2]
MB-07811 DM6JTSZ Hyperlipidaemia 5C80 Phase 2 [3]
MGL-3196 DM1HC9R Familial hypercholesterolemia 5C80.00 Phase 2 [4]
VK-2809 DMY5NUR Hypercholesterolaemia 5C80.0 Phase 2 [5]
Axitirome DM6L5IP Hyperlipidaemia 5C80 Phase 1 [6]
VK-0214 DM90GS3 X-linked Adrenoleukodystrophy 5C57 Phase 1 [7]
ZYT-1 DM1XOZK Lipid metabolism disorder 5C52.Z Phase 1 [2]
tiratricol DMZO6CV Wound healing EL8Y Clinical trial [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Clinical Trial Drug(s)
26 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(3,5-Dibromo-4-butoxy-phenyl)-acetic acid DM9PDCA Discovery agent N.A. Investigative [9]
(3,5-Dibromo-4-hexyloxy-phenyl)-acetic acid DM5GN46 Discovery agent N.A. Investigative [9]
(3,5-Dibromo-4-pentyloxy-phenyl)-acetic acid DMB5KVZ Discovery agent N.A. Investigative [9]
(4-hexylphenyl)(oxiran-2-yl)methanone DM1WZXL Discovery agent N.A. Investigative [10]
(E)-1-(4-heptylphenyl)but-2-en-1-one DMBXK5L Discovery agent N.A. Investigative [10]
(Z)-4-(4-hexylphenylamino)-4-oxobut-2-enoic acid DM30YQF Discovery agent N.A. Investigative [10]
1-(4-(Hexyloxy)phenyl)-3-morpholinopropan-1-one DMLODAM Discovery agent N.A. Investigative [11]
1-(4-heptylphenyl)prop-2-en-1-one DMIQ0VA Discovery agent N.A. Investigative [10]
1-(4-hexylphenyl)-3-(propylamino)propan-1-one DM5QLGH Discovery agent N.A. Investigative [10]
1-(4-hexylphenyl)-3-morpholinopropan-1-one DMFN8T6 Discovery agent N.A. Investigative [10]
1-(4-HEXYLPHENYL)PROP-2-EN-1-ONE DMX7PJH Discovery agent N.A. Investigative [12]
1-(4-octylphenyl)prop-2-en-1-one DM9KVBJ Discovery agent N.A. Investigative [10]
2-hexylphenyl acrylate DMTD0IG Discovery agent N.A. Investigative [10]
3-(3,5-Dibromo-4-hexyloxy-phenyl)-propionic acid DMDFHCU Discovery agent N.A. Investigative [9]
3-(4-(benzyloxy)-3,5-dibromophenyl)propanoic acid DM36VA0 Discovery agent N.A. Investigative [13]
3-(dibutylamino)-1-(4-hexylphenyl)propan-1-one DM2JBQI Discovery agent N.A. Investigative [10]
3-(dimethylamino)-1-(4-heptylphenyl)propan-1-one DMG5VMH Discovery agent N.A. Investigative [11]
3-(dimethylamino)-1-(4-hexylphenyl)propan-1-one DMJYCHG Discovery agent N.A. Investigative [10]
3-bromo-1-(4-hexylphenyl)propan-1-one DM03ROH Discovery agent N.A. Investigative [10]
4-(3-(Dimethylamino)propanoyl)-N-hexylbenzamide DMX5V9T Discovery agent N.A. Investigative [11]
4-(4-hexylphenyl)-4-oxobut-2-enoic acid DMR9TBW Discovery agent N.A. Investigative [10]
4-hexylphenyl propiolate DMONZ0Y Discovery agent N.A. Investigative [10]
Cacodylate Ion DMK4XLD Discovery agent N.A. Investigative [14]
Detrothyronine DMPCRSY Discovery agent N.A. Investigative [15]
GC-24 DMSF8B9 Hyperthyroidism 5A02 Investigative [14]
rT3 DMWDXPN Discovery agent N.A. Investigative [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 26 Investigative Drug(s)

References

1 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
2 Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
3 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 589).
4 Lipid lowering in healthy volunteers treated with multiple doses of MGL-3196, a liver-targeted thyroid hormone receptor-beta agonist. Atherosclerosis. 2013 Oct;230(2):373-80.
5 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
6 Bacterial biosensors for screening isoform-selective ligands for human thyroid receptors alpha-1 and beta-1. FEBS Open Bio. 2012; 2: 247-253.
7 Clinical pipeline report, company report or official report of Viking Therapeutics
8 Binding of 3,5,3'-triiodothyronine (T3) and its analogs to the in vitro translational products of c-erbA protooncogenes: differences in the affinity of the alpha- and beta-forms for the acetic acid analog and failure of the human testis and kidney alpha-2 products to bind T3. Mol Endocrinol. 1990 Feb;4(2):227-34.
9 Thyroid receptor ligands. 3. Design and synthesis of 3,5-dihalo-4-alkoxyphenylalkanoic acids as indirect antagonists of the thyroid hormone receptor. J Med Chem. 2005 May 5;48(9):3114-7.
10 Inhibitors of the interaction of a thyroid hormone receptor and coactivators: preliminary structure-activity relationships. J Med Chem. 2007 Nov 1;50(22):5269-80.
11 Improvement of pharmacological properties of irreversible thyroid receptor coactivator binding inhibitors. J Med Chem. 2009 Jul 9;52(13):3892-901.
12 The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
13 Thyroid receptor ligands. Part 7: Indirect antagonists of the thyroid hormone receptor with improved affinity. Bioorg Med Chem Lett. 2007 Apr 1;17(7):2018-21.
14 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
15 Thyroid receptor ligands. Part 5: novel bicyclic agonist ligands selective for the thyroid hormone receptor beta. Bioorg Med Chem Lett. 2006 Mar 1;16(5):1240-4.