Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTGQA9W)
DTT Name | Apolipoprotein A-II (APOA2) | ||||
---|---|---|---|---|---|
Synonyms | Apolipoprotein A2; ApoA-II; Apo-AII | ||||
Gene Name | APOA2 | ||||
DTT Type |
Literature-reported target
|
[1] | |||
BioChemical Class |
Apolipoprotein
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAE
AKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ |
||||
Function | May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism. | ||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||