Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTGTWLF)
DTT Name | Vasoactive intestinal polypeptide (VIP) | ||||
---|---|---|---|---|---|
Synonyms | Vasoactive intestinal peptide; VIP peptides; Peptide histidine valine 42; Intestinal peptide PHV-42 | ||||
Gene Name | VIP | ||||
DTT Type |
Literature-reported target
|
[1] | |||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDM
LQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPV PVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK |
||||
Function | VIP causes vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder. | ||||
KEGG Pathway | |||||
Reactome Pathway | |||||