Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTGUYTR)

• DTT Name: Interleukin-11 (IL11)
• Synonyms: Oprelvekin; IL-11; Adipogenesis inhibitory factor; AGIF
• Gene Name: IL11
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Cytokine: interleukin
• UniProt ID: IL11_HUMAN
• TTD ID: T56308
• Sequence:
  MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQL
  RDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLK
  TLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGG
  LHLTLDWAVRGLLLLKTRL
• Function: Promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2 activates a signaling cascade that promotes cell proliferation. Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3. Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Jak-STAT signaling pathway (hsa04630)
  Hematopoietic cell lineage (hsa04640)
  Rheumatoid arthritis (hsa05323)
• Reactome Pathway: IL-6-type cytokine receptor ligand interactions (R-HSA-6788467)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
VM-501	DM4P5UJ	Thrombocytopenia	3B64	Phase 3	[1]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Thrombocytopenia	3B64	Whole blood	7.66E-01	0.06	0.38

References

• [1] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033052)