Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTGZ5WN)

DTT Name	Leukemia inhibitory factor (LIF)
Synonyms	Melanoma-derived LPL inhibitor; MLPLI; HILDA; Emfilermin; Differentiation-stimulating factor; D factor
Gene Name	LIF
DTT Type	Clinical trial target	[1]
UniProt ID	LIF_HUMAN
TTD ID	T29774
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSAN ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNIT RDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQK KKLGCQLLGKYKQIIAVLAQAF
Function	Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes. LIF has the capacity to induce terminal differentiation in leukemic cells.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) Signaling pathways regulating pluripotency of stem cells (hsa04550 ) JAK-STAT signaling pathway (hsa04630 ) TNF signaling pathway (hsa04668 )
Reactome Pathway	Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 ) IL-6-type cytokine receptor ligand interactions (R-HSA-6788467 ) Interleukin-10 signaling (R-HSA-6783783 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
MSC-1	DM6XTZL	Solid tumour/cancer	2A00-2F9Z	Phase 1	[2]
------------------------------------------------------------------------------------

References

1	Biomarkers in psoriasis and psoriatic arthritis. Ann Rheum Dis. 2013 Apr;72 Suppl 2:ii104-10.
2	National Cancer Institute Drug Dictionary (drug name MSC-1).