| DTT Name |
Cyclic AMP-responsive element-binding protein (CREB1)
|
| Synonyms |
cAMP-responsive element-binding protein 1; Cyclic AMP-responsive element-binding protein 1; Cyclic AMP responseelement-binding protein; CREB-1; CREB; CAMP-response element binding protein |
| Gene Name |
CREB1
|
| DTT Type |
Literature-reported target
|
[1] |
| BioChemical Class |
Basic leucine zipper bZIP
|
| UniProt ID |
|
| TTD ID |
|
| 3D Structure |
|
| Sequence |
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
|
| Function |
Transcription activation is enhanced by the TORC coactivators which act independently of Ser-133 phosphorylation. Involved in different cellular processes including the synchronization of circadian rhythmicity and the differentiation of adipose cells. Phosphorylation-dependent transcription factor that stimulates transcription upon binding to the DNA cAMP response element (CRE), a sequence present in many viral and cellular promoters.
|
| KEGG Pathway |
- cGMP-PKG signaling pathway (hsa04022 )
- cAMP signaling pathway (hsa04024 )
- PI3K-Akt signaling pathway (hsa04151 )
- AMPK signaling pathway (hsa04152 )
- Longevity regulating pathway (hsa04211 )
- Adrenergic signaling in cardiomyocytes (hsa04261 )
- Osteoclast differentiation (hsa04380 )
- Antigen processing and presentation (hsa04612 )
- TNF signaling pathway (hsa04668 )
- Circadian rhythm (hsa04710 )
- Circadian entrainment (hsa04713 )
- Thermogenesis (hsa04714 )
- Cholinergic synapse (hsa04725 )
- Dopaminergic synapse (hsa04728 )
- Insulin secretion (hsa04911 )
- Estrogen signaling pathway (hsa04915 )
- Melanogenesis (hsa04916 )
- Thyroid hormone synthesis (hsa04918 )
- Glucagon signaling pathway (hsa04922 )
- Renin secretion (hsa04924 )
- Aldosterone synthesis and secretion (hsa04925 )
- Relaxin signaling pathway (hsa04926 )
- Cortisol synthesis and secretion (hsa04927 )
- Parathyroid hormone synthesis, secretion and action (hsa04928 )
- Insulin resistance (hsa04931 )
- Cushing syndrome (hsa04934 )
- Growth hormone synthesis, secretion and action (hsa04935 )
- Vasopressin-regulated water reabsorption (hsa04962 )
- Huntington disease (hsa05016 )
- Prion disease (hsa05020 )
- Cocaine addiction (hsa05030 )
- Amphetamine addiction (hsa05031 )
- Alcoholism (hsa05034 )
- Tuberculosis (hsa05152 )
- Hepatitis B (hsa05161 )
- Human cytomegalovirus infection (hsa05163 )
- Human papillomavirus infection (hsa05165 )
- Human T-cell leukemia virus 1 infection (hsa05166 )
- Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
- Viral carcinogenesis (hsa05203 )
- Chemical carcinogenesis - receptor activation (hsa05207 )
- Prostate cancer (hsa05215 )
|
| Reactome Pathway |
- CaMK IV-mediated phosphorylation of CREB (R-HSA-111932 )
- AKT phosphorylates targets in the nucleus (R-HSA-198693 )
- CREB phosphorylation (R-HSA-199920 )
- Transcriptional activation of mitochondrial biogenesis (R-HSA-2151201 )
- NOTCH2 intracellular domain regulates transcription (R-HSA-2197563 )
- NCAM signaling for neurite out-growth (R-HSA-375165 )
- Circadian Clock (R-HSA-400253 )
- CREB1 phosphorylation through the activation of Adenylate Cyclase (R-HSA-442720 )
- CREB1 phosphorylation through the activation of CaMKII/CaMKK/CaMKIV cascasde (R-HSA-442729 )
- CREB1 phosphorylation through NMDA receptor-mediated activation of RAS signaling (R-HSA-442742 )
- Constitutive Signaling by AKT1 E17K in Cancer (R-HSA-5674400 )
- Gastrin-CREB signalling pathway via PKC and MAPK (R-HSA-881907 )
- Regulation of MECP2 expression and activity (R-HSA-9022692 )
- MECP2 regulates neuronal receptors and channels (R-HSA-9022699 )
- MECP2 regulates transcription of neuronal ligands (R-HSA-9022702 )
- MECP2 regulates transcription factors (R-HSA-9022707 )
- NGF-stimulated transcription (R-HSA-9031628 )
- HCMV Early Events (R-HSA-9609690 )
- Transcriptional regulation of granulopoiesis (R-HSA-9616222 )
- Estrogen-dependent nuclear events downstream of ESR-membrane signaling (R-HSA-9634638 )
- ADORA2B mediated anti-inflammatory cytokines production (R-HSA-9660821 )
- FCGR3A-mediated IL10 synthesis (R-HSA-9664323 )
- Heme signaling (R-HSA-9707616 )
- PKA-mediated phosphorylation of CREB (R-HSA-111931 )
|
|
|
|
|
|
|
