Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTH53G9)
| DTT Name | Eukaryotic initiation factor 5A2 (EIF5A2) | ||||
|---|---|---|---|---|---|
| Synonyms | eIF5A2; eIF-5A2; eIF-5A-2; Eukaryotic translation initiation factor 5A-2; Eukaryotic initiation factor 5A isoform 2 | ||||
| Gene Name | EIF5A2 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Eukaryotic nuclear pore complex
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVG
IDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELG KEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK |
||||
| Function |
Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Functions as a regulator of apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. mRNA-binding protein involved in translation elongation.
|
||||
| Reactome Pathway | |||||