Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTH5MRS)
| DTT Name | Neuropsin (KLK8) | ||||
|---|---|---|---|---|---|
| Synonyms |
hK8; UNQ283/PRO322; Tumor-associated differentially expressed gene-14 protein; Tumor-associated differentially expressed gene 14 protein; TADG14; Serine protease TADG-14; Serine protease 19; PRSS19; Ovasin; Neuropsin (M(r) 25032); NRPN; NP; Kallikrein-8; Kallikrein 8; KLK8 (neuropsin/ovasin)
|
||||
| Gene Name | KLK8 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Peptidase
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| EC Number |
EC 3.4.21.118
|
||||
| Sequence |
MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGG
VLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHD LMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFP QKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPG VYTNICRYLDWIKKIIGSKG |
||||
| Function |
Cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury. Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV.
|
||||
| Reactome Pathway | |||||