Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTHAPJK)

DTT Name	C-C motif chemokine 23 (CCL23)
Synonyms	Small-inducible cytokine A23; SCYA23; Myeloid progenitor inhibitory factor 1; Macrophage inflammatory protein 3; MPIF1; MPIF-1; MIP3; MIP-3; CKB-8; CK-beta-8
Gene Name	CCL23
DTT Type	Literature-reported target	[1]
BioChemical Class	Cytokine: CC chemokine
UniProt ID	CCL23_HUMAN
TTD ID	T23934
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTP RSIPCSLLESYFETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN
Function	Inhibits proliferation of myeloid progenitor cells in colony formation assays. This protein can bind heparin. Binds CCR1. CCL23(19-99), CCL23(22-99), CCL23(27-99), CCL23(30-99) are more potent chemoattractants than the small-inducible cytokine A23. Shows chemotactic activity for monocytes, resting T-lymphocytes, and neutrophils, but not for activated lymphocytes.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) Viral protein interaction with cytokine and cytokine receptor (hsa04061 ) Chemokine signaling pathway (hsa04062 )
Reactome Pathway	G alpha (i) signalling events (R-HSA-418594 ) Formyl peptide receptors bind formyl peptides and many other ligands (R-HSA-444473 ) G alpha (q) signalling events (R-HSA-416476 )

References

1	Serum CCL23 levels are increased in patients with systemic sclerosis. Arch Dermatol Res. 2011 Jan;303(1):29-34.