Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTHN8EM)

• DTT Name: Islet amyloid polypeptide (IAPP)
• Synonyms: Insulinoma amyloid peptide; IAPP; Diabetes-associated peptide; Amylin
• Gene Name: IAPP
• DTT Type: Literature-reported target; [1]
• UniProt ID: IAPP_HUMAN
• TTD ID: T56269
• Sequence:
  MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAIL
  SSTNVGSNTYGKRNAVEVLKREPLNYLPL
• Function: Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism.
• KEGG Pathway:
  Neuroactive ligand-receptor interaction (hsa04080)
  Maturity onset diabetes of the young (hsa04950)
• Reactome Pathway:
  G alpha (s) signalling events (R-HSA-418555)
  Calcitonin-like ligand receptors (R-HSA-419812)
  ADORA2B mediated anti-inflammatory cytokines production (R-HSA-9660821)
  Amyloid fiber formation (R-HSA-977225)
  Regulation of gene expression in beta cells (R-HSA-210745)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
LY 3541105	DMJ1X85	Obesity	5B81	Phase 1	[2]

References

• [1] Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34.
• [2] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2023. Adis Insight