Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTHOI91)

• DTT Name: NIMA-related kinase 6 (NEK6)
• Synonyms: Serine/threonine-protein kinase Nek6; Protein kinase SID6-1512; NimA-related protein kinase 6; Never in mitosis A-related kinase 6
• Gene Name: NEK6
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Kinase
• UniProt ID: NEK6_HUMAN
• TTD ID: T30829
• EC Number: EC 2.7.11.1
• Sequence:
  MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVY
  KATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNI
  VLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFI
  TATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEM
  AALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVH
  QVAKQMHIWMSST
• Function: Required for chromosome segregation at metaphase-anaphase transition, robust mitotic spindle formation and cytokinesis. Phosphorylates ATF4, CIR1, PTN, RAD26L, RBBP6, RPS7, RPS6KB1, TRIP4, STAT3 and histones H1 and H3. Phosphorylates KIF11 to promote mitotic spindle formation. Involved in G2/M phase cell cycle arrest induced by DNA damage. Inhibition of activity results in apoptosis. May contribute to tumorigenesis by suppressing p53/TP53-induced cancer cell senescence. Protein kinase which plays an important role in mitotic cell cycle progression.
• Reactome Pathway:
  Nuclear Pore Complex (NPC) Disassembly (R-HSA-3301854)
  EML4 and NUDC in mitotic spindle formation (R-HSA-9648025)
  Activation of NIMA Kinases NEK9, NEK6, NEK7 (R-HSA-2980767)

Molecular Interaction Atlas (MIA) of This DTT

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PMID20462760C22	DMQFKBI	Discovery agent	N.A.	Investigative	[1]

References

• [1] Substituted 2H-isoquinolin-1-one as potent Rho-Kinase inhibitors. Part 1: Hit-to-lead account. Bioorg Med Chem Lett. 2010 Jun 1;20(11):3235-9.