Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTHU7JA)

• DTT Name: Tumor susceptibility gene protein 101 (TSG101)
• Synonyms: Tumor susceptibility gene 101 protein; ESCRT-I complex subunit TSG101
• Gene Name: TSG101
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Ubiquitin-conjugating enzyme
• UniProt ID: TS101_HUMAN
• TTD ID: T01283
• Sequence:
  MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIP
  VPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP
  QSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNTSYMPGMPGGISPYPSGYPP
  NPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRW
  RMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSS
  ALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFL
  KHVRLLSRKQFQLRALMQKARKTAGLSDLY
• Function: Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis; the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator. Involved in the budding of many viruses through an interaction with viral proteins that contain a late-budding motif P-[ST]-A-P. This interaction is essential for viral particle budding of numerous retroviruses. Required for the exosomal release of SDCBP, CD63 and syndecan. It may also play a role in the extracellular release of microvesicles that differ from the exosomes. Component of the ESCRT-I complex, a regulator of vesicular trafficking process.
• KEGG Pathway: Endocytosis (hsa04144)
• Reactome Pathway:
  Membrane binding and targetting of GAG proteins (R-HSA-174490)
  Budding and maturation of HIV virion (R-HSA-162588)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
FGI-101-1A6	DM8U2IE	Influenza virus infection	1E30-1E32	Phase 1	[1]

References

• [1] ClinicalTrials.gov (NCT01299142) Safety and Pharmacokinetics Study of Human Monoclonal Antibody (FGI-101-1A6). U.S. National Institutes of Health.