Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTI0KH6)

• DTT Name: TGF beta-2 messenger RNA (TGFB2 mRNA)
• Synonyms: Transforming growth factor beta-2 proprotein (mRNA); TGF-beta 2 (mRNA); Polyergin (mRNA); Glioblastoma-derived T-cell suppressor factor (mRNA); G-TSF (mRNA); Cetermin (mRNA); BSC-1 cell growth inhibitor (mRNA)
• Gene Name: TGFB2
• DTT Type: Clinical trial target; [1]
• BioChemical Class: mRNA target
• UniProt ID: TGFB2_HUMAN
• TTD ID: T44771
• Sequence:
  MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
  EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP
  TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP
  TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP
  NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQTNRRK
  KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
  SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
• Function: Transforming growth factor beta-2 proprotein: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-2 (TGF-beta-2) chains, which constitute the regulatory and active subunit of TGF-beta-2, respectively.
• KEGG Pathway:
  MAPK signaling pathway (hsa04010)
  Cytokine-cytokine receptor interaction (hsa04060)
  FoxO signaling pathway (hsa04068)
  Cell cycle (hsa04110)
  Endocytosis (hsa04144)
  TGF-beta signaling pathway (hsa04350)
  Osteoclast differentiation (hsa04380)
  Hippo signaling pathway (hsa04390)
  Leishmaniasis (hsa05140)
  Chagas disease (American trypanosomiasis) (hsa05142)
  Malaria (hsa05144)
  Toxoplasmosis (hsa05145)
  Amoebiasis (hsa05146)
  Tuberculosis (hsa05152)
  Hepatitis B (hsa05161)
  HTLV-I infection (hsa05166)
  Pathways in cancer (hsa05200)
  Proteoglycans in cancer (hsa05205)
  MicroRNAs in cancer (hsa05206)
  Colorectal cancer (hsa05210)
  Renal cell carcinoma (hsa05211)
  Pancreatic cancer (hsa05212)
  Chronic myeloid leukemia (hsa05220)
  Inflammatory bowel disease (IBD) (hsa05321)
  Rheumatoid arthritis (hsa05323)
  Hypertrophic cardiomyopathy (HCM) (hsa05410)
  Dilated cardiomyopathy (hsa05414)
• Reactome Pathway:
  Molecules associated with elastic fibres (R-HSA-2129379)
  ECM proteoglycans (R-HSA-3000178)
  Platelet degranulation (R-HSA-114608)

Molecular Interaction Atlas (MIA) of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Belagenpumatucel-L	DMQG7ZM	Non-small-cell lung cancer	2C25.Y	Phase 3	[1]
OT-101	DMCTRLN	Melanoma	2C30	Phase 2/3	[2]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Ranagengliotucel-T	DMNTURD	Brain cancer	2A00	Discontinued in Phase 3	[3]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Lung cancer	2C82	Lung tissue	1.51E-17	-0.53	-0.77
Neuroectodermal tumour	2C82	Nervous tissue	4.12E-39	0.35	0.73
Ovarian cancer	2C82	Ovarian tissue	9.68E-01	-0.19	-0.49

References

• [1] National Cancer Institute Drug Dictionary (drug id 590662).
• [2] Clinical pipeline report, company report or official report of Oncotelic.
• [3] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017210)