Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTI0ME6)
| DTT Name | Suppressor of cytokine signaling 3 (SOCS3) | ||||
|---|---|---|---|---|---|
| Synonyms | STAT-induced STAT inhibitor 3; STAT induced STAT inhibitor 3; SSI3; SSI-3; SOCS-3; Cytokine-inducible SH2 protein 3; CIS3; CIS-3 | ||||
| Gene Name | SOCS3 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL |
||||
| Function |
SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including gp130, LIF, erythropoietin, insulin, IL12, GCSF and leptin receptors. Binding to JAK2 inhibits its kinase activity. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Regulates IL-6 signaling in vivo. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize IL6ST. SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction.
|
||||
| KEGG Pathway |
|
||||
| Reactome Pathway |
|
||||
