Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTI2YFK)
DTT Name | CMRF35-like molecule 8 (CD300A) | ||||
---|---|---|---|---|---|
Synonyms |
NK inhibitory receptor; Inhibitory receptor protein 60; Immunoglobulin superfamily member 12; IgSF12; IRp60; IRC1/IRC2; HSPC083; CMRF35H; CMRF35-H9; CMRF35-H; CMRF-35-H9; CLM-8; CD300a; CD300 antigen-like family member A
|
||||
Gene Name | CD300A | ||||
DTT Type |
Literature-reported target
|
[1] | |||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MWLPWALLLLWVPGCFALSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDK
IVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEV EVSVFPASTSMTPASITAAKTSTITTAFPPVSSTTLFAVGATHSASIQEETEEVVNSQLP LLLSLLALLLLLLVGASLLAWRMFQKWIKAGDHSELSQNPKQAATQSELHYANLELLMWP LQEKPAPPREVEVEYSTVASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRKT |
||||
Function |
Negatively regulates the Toll-like receptor (TLR) signaling mediated by MYD88 but not TRIF through activation of PTPN6. Inhibitory receptor which may contribute to the down-regulation of cytolytic activity in natural killer (NK) cells, and to the down-regulation of mast cell degranulation.
|
||||
Reactome Pathway | |||||