Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTI3NXG)

• DTT Name: Human immunodeficiency virus Matrix p17 (HIV MA)
• Synonyms: gag
• Gene Name: HIV MA
• DTT Type: Clinical trial target; [1]
• Related Disease: Human immunodeficiency virus disease [ICD-11: 1C60-1C62]
• UniProt ID: POL_HV1B1
• TTD ID: T13409
• Sequence:
  GARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQIL
  GQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAAD
  TGHSSQVSQNY
• Function: p6-gag: Plays a role in budding of the assembled particle by interacting with the host class E VPS proteins TSG101 and PDCD6IP/AIP1.
• Reactome Pathway:
  Budding and maturation of HIV virion (R-HSA-162588)
  Integration of provirus (R-HSA-162592)
  Early Phase of HIV Life Cycle (R-HSA-162594)
  Minus-strand DNA synthesis (R-HSA-164516)
  Plus-strand DNA synthesis (R-HSA-164525)
  2-LTR circle formation (R-HSA-164843)
  Binding and entry of HIV virion (R-HSA-173107)
  Membrane binding and targetting of GAG proteins (R-HSA-174490)
  Assembly Of The HIV Virion (R-HSA-175474)
  Integration of viral DNA into host genomic DNA (R-HSA-175567)
  Autointegration results in viral DNA circles (R-HSA-177539)
  APOBEC3G mediated resistance to HIV-1 infection (R-HSA-180689)
  Vpr-mediated nuclear import of PICs (R-HSA-180910)
  Uncoating of the HIV Virion (R-HSA-162585)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
F4co vaccine	DM6UQNW	Human immunodeficiency virus infection	1C62	Phase 2	[1]

References

• [1] EP patent application no. 2621528, Vaccine.