Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTIDSFT)

• DTT Name: ADP-ribosylation factor-like protein 2 (ARL2)
• Synonyms: ARFL2
• Gene Name: ARL2
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Small GTPase
• UniProt ID: ARL2_HUMAN
• TTD ID: T95553
• Sequence:
  MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGF
  KLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATL
  LIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRI
  FTAD
• Function: GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Regulates formation of new microtubules and centrosome integrity. Prevents the TBCD-induced microtubule destruction. Participates in association with TBCD, in the disassembly of the apical junction complexes. Antagonizes the effect of TBCD on epithelial cell detachment and tight and adherens junctions disassembly. Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. Component of a regulated secretory pathway involved in Ca(2+)-dependent release of acetylcholine. Required for normal progress through the cell cycle. Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP).
• Reactome Pathway:
  Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane (R-HSA-83936)
  RAS processing (R-HSA-9648002)
  Post-chaperonin tubulin folding pathway (R-HSA-389977)

References

• [1] MicroRNA-497-5p Suppresses Tumor Cell Growth of Osteosarcoma by Targeting ADP Ribosylation Factor-Like Protein 2. Cancer Biother Radiopharm. 2017 Dec;32(10):371-378.