Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTIPNSR)

DTT Name	Polycomb complex protein BMI-1 (BMI1)
Synonyms	RNF51; RING finger protein 51; Polycomb group RING finger protein 4; PCGF4
Gene Name	BMI1
DTT Type	Literature-reported target	[1]
BioChemical Class	Zinc-finger
UniProt ID	BMI1_HUMAN
TTD ID	T74066
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQV HKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE DKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLR SKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQR DGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSP SGNHQSSFANRPRKSSVNGSSATSSG
Function	PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. The complex composed of RNF2, UB2D3 and BMI1 binds nucleosomes, and has activity only with nucleosomal histone H2A. In the PRC1-like complex, regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2. Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development.
KEGG Pathway	Signaling pathways regulating pluripotency of stem cells (hsa04550 ) Transcriptional misregulation in cancer (hsa05202 ) MicroRNAs in cancer (hsa05206 )
Reactome Pathway	SUMOylation of DNA damage response and repair proteins (R-HSA-3108214 ) SUMOylation of transcription cofactors (R-HSA-3899300 ) SUMOylation of chromatin organization proteins (R-HSA-4551638 ) SUMOylation of RNA binding proteins (R-HSA-4570464 ) SUMOylation of DNA methylation proteins (R-HSA-4655427 ) RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known (R-HSA-8939243 ) Regulation of PTEN gene transcription (R-HSA-8943724 ) Transcriptional Regulation by E2F6 (R-HSA-8953750 ) Oxidative Stress Induced Senescence (R-HSA-2559580 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Unesbulin	DM4M2MO	Leiomyosarcoma	2B58	Phase 2/3	[2]
------------------------------------------------------------------------------------

References

1	The expression and prognostic value of stem cell markers Bmi-1, HESC5:3, and HES77 in human papillomavirus-positive and -negative oropharyngeal squ... Tumour Biol. 2019 Mar;41(3):1010428319840473.
2	Rationale for Combining the BCL2 Inhibitor Venetoclax with the PI3K Inhibitor Bimiralisib in the Treatment of IDH2- and FLT3-Mutated Acute Myeloid Leukemia. Int J Mol Sci. 2022 Oct 20;23(20):12587.