| DTT Name |
Fibroblast growth factor-8 (FGF8)
|
| Synonyms |
Heparin-binding growth factor 8; HBGF-8; Fibroblast growth factor 8; FGF-8; Androgen-induced growth factor; AIGF |
| Gene Name |
FGF8
|
| DTT Type |
Literature-reported target
|
[1] |
| BioChemical Class |
Growth factor
|
| UniProt ID |
|
| TTD ID |
|
| 3D Structure |
|
| Sequence |
MGSPRSALSCLLLHLLVLCLQAQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLV
TDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGA
ETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKG
SKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
|
| Function |
Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Plays a role in neurite outgrowth in hippocampal cells. Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration.
|
| KEGG Pathway |
- MAPK signaling pathway (hsa04010 )
- Ras signaling pathway (hsa04014 )
- Rap1 signaling pathway (hsa04015 )
- Calcium signaling pathway (hsa04020 )
- PI3K-Akt signaling pathway (hsa04151 )
- Regulation of actin cytoskeleton (hsa04810 )
- Pathways in cancer (hsa05200 )
- Chemical carcinogenesis - receptor activation (hsa05207 )
- Melanoma (hsa05218 )
- Breast cancer (hsa05224 )
- Gastric cancer (hsa05226 )
|
| Reactome Pathway |
- PIP3 activates AKT signaling (R-HSA-1257604 )
- Signaling by activated point mutants of FGFR1 (R-HSA-1839122 )
- Signaling by activated point mutants of FGFR3 (R-HSA-1839130 )
- FGFR4 ligand binding and activation (R-HSA-190322 )
- FGFR3b ligand binding and activation (R-HSA-190371 )
- FGFR3c ligand binding and activation (R-HSA-190372 )
- FGFR1c ligand binding and activation (R-HSA-190373 )
- FGFR2c ligand binding and activation (R-HSA-190375 )
- Activated point mutants of FGFR2 (R-HSA-2033519 )
- Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530 )
- Phospholipase C-mediated cascade (R-HSA-5654219 )
- Phospholipase C-mediated cascade, FGFR2 (R-HSA-5654221 )
- Phospholipase C-mediated cascade, FGFR3 (R-HSA-5654227 )
- Phospholipase C-mediated cascade, FGFR4 (R-HSA-5654228 )
- Downstream signaling of activated FGFR1 (R-HSA-5654687 )
- SHC-mediated cascade (R-HSA-5654688 )
- PI-3K cascade (R-HSA-5654689 )
- FRS-mediated FGFR1 signaling (R-HSA-5654693 )
- PI-3K cascade (R-HSA-5654695 )
- SHC-mediated cascade (R-HSA-5654699 )
- FRS-mediated FGFR2 signaling (R-HSA-5654700 )
- SHC-mediated cascade (R-HSA-5654704 )
- FRS-mediated FGFR3 signaling (R-HSA-5654706 )
- PI-3K cascade (R-HSA-5654710 )
- FRS-mediated FGFR4 signaling (R-HSA-5654712 )
- SHC-mediated cascade (R-HSA-5654719 )
- PI-3K cascade (R-HSA-5654720 )
- Negative regulation of FGFR1 signaling (R-HSA-5654726 )
- Negative regulation of FGFR2 signaling (R-HSA-5654727 )
- Negative regulation of FGFR3 signaling (R-HSA-5654732 )
- Negative regulation of FGFR4 signaling (R-HSA-5654733 )
- Signaling by FGFR2 in disease (R-HSA-5655253 )
- Signaling by FGFR1 in disease (R-HSA-5655302 )
- Signaling by FGFR3 in disease (R-HSA-5655332 )
- FGFRL1 modulation of FGFR1 signaling (R-HSA-5658623 )
- RAF/MAP kinase cascade (R-HSA-5673001 )
- PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558 )
- PI3K Cascade (R-HSA-109704 )
|
|
|
|
|
|
|
