Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTIVCNR)
| DTT Name | Eukaryotic translation initiation factor 5A-1 (EIF5A) | ||||
|---|---|---|---|---|---|
| Synonyms | eIF-5A1; eIF-5A-1; eIF-5A; eIF-4D; Rev-binding factor; Eukaryotic initiation factor 5A isoform 1 | ||||
| Gene Name | EIF5A | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVG
IDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLG KEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK |
||||
| Function |
A GTPase-activating protein, which helps the large ribosomal subunit associate with the small subunit. Involved in the initiation phase of eukaryotic translation. Stabilize the formation of ribosomal preinitiation complexes around the start codon and are an important input for post-transcription gene regulation. Helps with elongation and also plays a role in termination.
|
||||
| Reactome Pathway | |||||