Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTIVY12)

DTT Name	Beta-defensin 4A (DEFB4A)
Synonyms	hBD2; Skinantimicrobial peptide 1; SAP1; Defensin, beta 2; DEFB4B; DEFB4A; Betadefensin 4A; Betadefensin 2; BD2
Gene Name	DEFB4A
DTT Type	Literature-reported target	[1]
UniProt ID	DFB4A_HUMAN
TTD ID	T43881
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKC CKKP
Function	Has antibacterial activity.
KEGG Pathway	NOD-like receptor signaling pathway (hsa04621 ) IL-17 signaling pathway (hsa04657 ) Staphylococcus aureus infection (hsa05150 )
Reactome Pathway	Defensins (R-HSA-1461973 ) Beta defensins (R-HSA-1461957 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
rHuB-D2	DMW1VOB	Discovery agent	N.A.	Investigative	[1]
------------------------------------------------------------------------------------

References

1	Bioactive coating of titanium surfaces with recombinant human -defensin-2 (rHuD2) may prevent bacterial colonization in orthopaedic surgery.J Bone Joint Surg Am.2011 May 4;93(9):840-6.