Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTIXUDE)
| DTT Name | S100 calcium-binding protein G (S100G) | ||||
|---|---|---|---|---|---|
| Synonyms | Vitamin D-dependent calcium-binding protein, intestinal; S100D; Protein S100-G; Calbindin-D9k; CALB3; CABP9K; CABP | ||||
| Gene Name | S100G | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
S100 calcium-binding protein
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKN
GDGEVSFEEFQVLVKKISQ |
||||
| Function |
Vitamin D-dependent. Its expression correlates with calcium transport activity. May increase Ca2+ absorption by buffering Ca2+ in the cytoplasm and increase ATP-dependent Ca2+ transport in duodenal basolateral membrane vesicles.
|
||||
| KEGG Pathway | |||||