Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTJ13ST)

• DTT Name: Inward rectifier potassium channel Kir1.1 (KCNJ1)
• Synonyms: ROMK1; Potassium channel, inwardly rectifying subfamily J member 1; Inward rectifier K(+) channel Kir1.1; ATP-sensitive inward rectifier potassium channel 1
• Gene Name: KCNJ1
• DTT Type: Patented-recorded target; [1]
• BioChemical Class: Inward rectifier potassium channel
• UniProt ID: KCNJ1_HUMAN
• TTD ID: T78710
• Sequence:
  MNASSRNVFDTLIRVLTESMFKHLRKWVVTRFFGHSRQRARLVSKDGRCNIEFGNVEAQS
  RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTP
  CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVIINSFMCGAILA
  KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
  TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGT
  VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
  NEKDVRARMKRGYDNPNFILSEVNETDDTKM
• Function: Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This channel is activated by internal ATP and can be blocked by external barium. In the kidney, probably plays a major role in potassium homeostasis.
• KEGG Pathway:
  Aldosterone-regulated sodium reabsorption (hsa04960)
  Gastric acid secretion (hsa04971)
• Reactome Pathway: Potassium transport channels (R-HSA-1296067)

Molecular Interaction Atlas (MIA) of This DTT

52 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PMID26004420-Compound-U2014S0288042A	DM8FQJB	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-U2014S0288042C	DM8RJTQ	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-US20140031349A	DMVQSYT	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-US20140031349B	DM3M1NB	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-US20140031349C	DMDP8J0	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-US20140031349D	DMUD7IB	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-US20140142115A	DMIXVNQ	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-US20140142115B	DM07DC6	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-US20140142115C	DMQ7Z5F	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-US20140275020D	DMQ5AIT	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-US20140275020E	DMH7JKI	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-US20140309213A	DMH8M1D	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-US20140309213B	DM0P4TA	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-US20140336177D	DM4M2TU	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-US20140336177E	DMCRJO1	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2010129379A	DM37GMQ	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2010129379B	DM62A1H	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2010129379C	DMV3X64	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2012058116A	DMR9B2D	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2012058116B	DMD41UF	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2012058116C	DM2Y64W	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2012058134A	DMUX0SG	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2012058134B	DMGVXCL	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2012058134C	DM9AJVK	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2013028474A	DMIV92A	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2013028474B	DMCP0WF	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2013028474C	DMTCPNY	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2013039802A	DMT7GQ1	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2013039802B	DMP130R	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2013039802C	DMV7ISR	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2013062892D	DMH7E38	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2013062892E	DMMHLA9	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2013062900A	DM5N9M4	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2013062900B	DMIM8UF	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2013062900C	DMDZHAB	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2014015495A	DMRDUS9	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2014015495B	DMLH637	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2014015495C	DMHA18O	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2014015495D	DM3QO5R	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2014085210A	DMY6JAB	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2014085210B	DMTD0RK	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2014085210C	DMKC6SA	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2014099633D	DMJIZWR	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2014099633E	DMSPG8Y	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2014126944A	DM59INV	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2014126944B	DMH0LBI	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2014150132A	DMN1B3F	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2014150132B	DMJX8WY	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2014150132C	DM2FDCT	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2015017305D	DMI30GA	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2015017305E	DMV4HQ5	N. A.	N. A.	Patented	[1]
PMID26004420-Compound-WO2015017305F	DMLV6IY	N. A.	N. A.	Patented	[1]

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
VU591	DMX9ED1	Discovery agent	N.A.	Investigative	[2]

References

• [1] Inhibitors of the renal outer medullary potassium channel: a patent review.Expert Opin Ther Pat. 2015;25(9):1035-51.
• [2] Development of a selective small-molecule inhibitor of Kir1.1, the renal outer medullary potassium channel. Mol Pharmacol. 2011 Jan;79(1):42-50.