Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTJR60Z)

DTT Name	Endothelin-1 (EDN1)
Synonyms	Preproendothelin-1; PPET1
Gene Name	EDN1
DTT Type	Literature-reported target	[1]
BioChemical Class	Endothelin/sarafotoxin
UniProt ID	EDN1_HUMAN
TTD ID	T25076
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMD KECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCW NFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSE TMRNSVKSSFHDPKLKGKPSRERYVTHNRAHW
Function	Endothelins are endothelium-derived vasoconstrictor peptides.
KEGG Pathway	cAMP signaling pathway (hsa04024 ) HIF-1 signaling pathway (hsa04066 ) Neuroactive ligand-receptor interaction (hsa04080 ) Vascular smooth muscle contraction (hsa04270 ) TNF signaling pathway (hsa04668 ) Melanogenesis (hsa04916 ) Renin secretion (hsa04924 ) Relaxin signaling pathway (hsa04926 ) AGE-RAGE signaling pathway in diabetic complications (hsa04933 ) Pathways in cancer (hsa05200 ) Hypertrophic cardiomyopathy (hsa05410 ) Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway	G alpha (q) signalling events (R-HSA-416476 ) Peptide ligand-binding receptors (R-HSA-375276 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Tetramethylpyrazine	DMC0WNB	Neurological disorder	6B60	Discontinued in Phase 2	[2]
------------------------------------------------------------------------------------

References

1	Predictive value of biomarkers in patients with heart failure. Curr Med Chem. 2012;19(16):2534-47.
2	Tetramethylpyrazine, a Chinese drug, blocks coronary vasoconstriction by endothelin-1 and decreases plasma endothelin-1 levels in experimental animals. J Cardiovasc Pharmacol. 1998;31 Suppl 1:S313-6.