Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTJTRMK)
DTT Name | Interleukin 10 receptor (IL10RB) | ||||
---|---|---|---|---|---|
Synonyms |
Interleukin-10 receptor subunit beta; Interleukin-10 receptor subunit 2; IL-10RB; IL-10R2; IL-10R subunit beta; IL-10R subunit 2; IL-10 receptor subunit beta; D21S66; D21S58; Cytokine receptor family 2 member 4; Cytokine receptor class-II member 4; CRFB4; CRF2-4; CDw210b
|
||||
Gene Name | IL10RB | ||||
DTT Type |
Literature-reported target
|
[1] | |||
BioChemical Class |
Cytokine receptor
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYR
IFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQV EVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRN LEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLG CFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAE DSESGKQNPGDSCSLGTPPGQGPQS |
||||
Function |
The IFNLR1/IL10RB dimer is a receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity. The ligand/receptor complex stimulate the activation of the JAK/STAT signaling pathway leading to the expression of IFN-stimulated genes (ISG), which contribute to the antiviral state. Shared cell surface receptor required for the activation of five class 2 cytokines: IL10, IL22, IL26, IL28, and IFNL1.
|
||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
3 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||||||||