Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTJZQYH)
DTT Name | CASP8-FADD-like regulator (CFLAR) | ||||
---|---|---|---|---|---|
Synonyms |
cFLIP; c-FLIP; Usurpin; MRIT; MACHrelated inducer of toxicity; MACH-related inducer of toxicity; Inhibitor of FLICE; IFLICE; I-FLICE; FLAME1; FLAME-1; FADDlike antiapoptotic molecule 1; FADD-like antiapoptotic molecule 1; Cellular FLICElike inhibitory protein; Cellular FLICE-like inhibitory protein; Casper; Caspaselike apoptosis regulatory protein; Caspaseeightrelated protein; Caspase-like apoptosis regulatory protein; Caspase-eight-related protein; Caspase homolog; CLARP; CASP8AP1; CASP8 and FADDlike apoptosis regulator subunit p12; CASP8 and FADDlike apoptosis regulator; CASP8 and FADD-like apoptosis regulator; CASH
|
||||
Gene Name | CFLAR | ||||
DTT Type |
Literature-reported target
|
[1] | |||
BioChemical Class |
Peptidase
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLY
RVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYM GRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGT SYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIP EERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMP EHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNY VVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSP SLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT |
||||
Function |
Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity. Apoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells.
|
||||
KEGG Pathway | |||||
Reactome Pathway | |||||