Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTK5OG6)
| DTT Name | Proteolipid protein 2 (PLP2) | ||||
|---|---|---|---|---|---|
| Synonyms | PLP2; Intestinal membrane A4 protein; Differentiation-dependent protein A4 | ||||
| Gene Name | PLP2 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Plasmolipin family
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILA
AIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLI ATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV |
||||
| Function | May play a role in cell differentiation in the intestinal epithelium. | ||||