Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTKB7T3)
| DTT Name | G0/G1 switch regulatory protein 8 (RGS2) | ||||
|---|---|---|---|---|---|
| Synonyms | Regulator of G-protein signaling 2; GIG31; G0S8; Cell growth-inhibiting gene 31 protein | ||||
| Gene Name | RGS2 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKT
GKKSKQQAFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL MENNSYPRFLESEFYQDLCKKPQITTEPHAT |
||||
| Function |
Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. It is involved in the negative regulation of the angiotensin-activated signaling pathway. Plays a role in the regulation of blood pressure in response to signaling via G protein-coupled receptors and GNAQ. Plays a role in regulating the constriction and relaxation of vascular smooth muscle. Binds EIF2B5 and blocks its activity, thereby inhibiting the translation of mRNA into protein. Regulates G protein-coupled receptor signaling cascades.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||