Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTKF4WV)
| DTT Name | Connecting peptide (C-peptide) | ||||
|---|---|---|---|---|---|
| Synonyms | Fetuin-A; Alpha-2-Z-globulin; Alpha-2-HS-glycoprotein chainB; Alpha-2-HS-glycoprotein (301-340); AHSG | ||||
| Gene Name | AHSG | ||||
| DTT Type |
Clinical trial target
|
[1] | |||
| BioChemical Class |
Fetuin family
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
LAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTR
|
||||
| Function | Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Shows affinity for calcium and barium ions. | ||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||