Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTKGY3F)
DTT Name | Mycobacterium DTDP-dehydrorhamnose epimerase rmlC (MycB rmlC) | ||||
---|---|---|---|---|---|
Synonyms |
dTDP-L-rhamnose synthase; dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase; dTDP-4-keto-6-deoxyglucose 3,5-epimerase; dTDP-4-dehydrorhamnose 3,5-epimerase; Thymidine diphospho-4-keto-rhamnose 3,5-epimerase
|
||||
Gene Name | MycB rmlC | ||||
DTT Type |
Literature-reported target
|
[1] | |||
BioChemical Class |
Racemases and epimerases
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
EC Number |
EC 5.1.3.13
|
||||
Sequence |
MKARELDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLDVRQVNCSVSSAGVLRG
LHFAQLPPSQAKYVTCVSGSVFDVVVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHG FLALQDNSTVMYLCSAEYNPQREHTICATDPTLAVDWPLVDGAAPSLSDRDAAAPSFEDV RASGLLPRWEQTQRFIGEMRGT |
||||
Function |
Catalyzes the epimerization of the C3' and C5'positions of dTDP-6-deoxy-D-xylo-4-hexulose, forming dTDP-6-deoxy-L-lyxo-4-hexulose. Involved in the biosynthesis of the dTDP-L-rhamnose which is a component of the critical linker, D-N-acetylglucosamine-L-rhamnose disaccharide, which connects the galactan region of arabinogalactan to peptidoglycan via a phosphodiester linkage.
|
||||
KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||