Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTKSND3)

• DTT Name: Lectin-like oxidized LDL receptor (OLR1)
• Synonyms: hLOX-1; Oxidized low-density lipoprotein receptor 1; Oxidized low-density lipoprotein receptor; Oxidised low density lipoprotein (Lectin-like) receptor 1; Ox-LDL receptor 1; Lectin-type oxidized LDL receptor 1; Lectin-type oxidized LDL receptor; Lectin-like oxidized low-density lipoprotein receptor-1; Lectin-like oxidized LDL receptor-1; Lectin-like oxidized LDL receptor 1; Lectin-like oxLDL receptor 1; LOX1; LOX-1; CLEC8A; C-type lectin domain family 8 member A
• Gene Name: OLR1
• DTT Type: Discontinued target; [1]
• UniProt ID: OLR1_HUMAN
• TTD ID: T49630
• Sequence:
  MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQL
  SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQ
  MELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLL
  KINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPS
  GTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
• Function: OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro-oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro-atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram-positive bacteria. Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells.
• KEGG Pathway:
  PPAR signaling pathway (hsa03320)
  Phagosome (hsa04145)
  Lipid and atherosclerosis (hsa05417)
• Reactome Pathway:
  Neutrophil degranulation (R-HSA-6798695)
  Cell surface interactions at the vascular wall (R-HSA-202733)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
MEDI6570	DML8S0W	Cardiovascular disease	BA00-BE2Z	Phase 2	[2]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
RG7418	DMXRHDL	Arteriosclerosis	BD40	Discontinued in Phase 1	[1]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Coronary artery disease	BA80-BA8Z	Peripheral blood	3.35E-01	-0.08	-0.35

References

• [1] Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
• [2] Clinical pipeline report, company report or official report of AstraZeneca