Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTKVENM)

• DTT Name: Herpes virus entry mediator ligand (CD258)
• Synonyms: UNQ391/PRO726; Tumor necrosis factor ligand superfamily member 14, soluble form; Tumor necrosis factor ligand superfamily member 14; LIGHT; Herpesvirus entry mediator ligand; HVEML; HVEM-L
• Gene Name: TNFSF14
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Cytokine: tumor necrosis factor
• UniProt ID: TNF14_HUMAN
• TTD ID: T48881
• Sequence:
  MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQ
  LHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGL
  AFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELL
  VSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
• Function: Binding to the decoy receptor TNFRSF6B modulates its effects. Acts as a ligand for TNFRSF14/HVEM. Upon binding to TNFRSF14/HVEM, delivers costimulatory signals to T cells, leading to T cell proliferation and IFNG production. Cytokine that binds to TNFRSF3/LTBR.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Viral protein interaction with cytokine and cytokine receptor (hsa04061)
  NF-kappa B signaling pathway (hsa04064)
  Herpes simplex virus 1 infection (hsa05168)
• Reactome Pathway:
  TNFs bind their physiological receptors (R-HSA-5669034)
  TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway (R-HSA-5676594)
  TNFR2 non-canonical NF-kB pathway (R-HSA-5668541)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AVTX-002	DM7A92T	Non-eosinophilic asthma	CA23	Phase 2	[2]

References

• [1] TNFRSF14 deficiency protects against ovariectomy-induced adipose tissue inflammation. J Endocrinol. 2013 Nov 28;220(1):25-33.
• [2] Clinical pipeline report, company report or official report of Avalo Therapeutics