| DTT Name |
Guanine nucleotide-binding alpha-q (GNAQ)
|
| Synonyms |
GNAQ; G alphaq; G alpha(q) |
| Gene Name |
GNAQ
|
| DTT Type |
Literature-reported target
|
[1] |
| UniProt ID |
|
| TTD ID |
|
| 3D Structure |
|
| Sequence |
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
|
| Function |
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Regulates B-cell selection and survival and is required to prevent B-cell-dependent autoimmunity. Regulates chemotaxis of BM-derived neutrophils and dendritic cells (in vitro).
|
| KEGG Pathway |
- Rap1 signaling pathway (hsa04015 )
- Calcium signaling pathway (hsa04020 )
- cGMP-PKG signaling pathway (hsa04022 )
- Chemokine signaling pathway (hsa04062 )
- Sphingolipid signaling pathway (hsa04071 )
- Adrenergic signaling in cardiomyocytes (hsa04261 )
- Vascular smooth muscle contraction (hsa04270 )
- Apelin signaling pathway (hsa04371 )
- Gap junction (hsa04540 )
- Platelet activation (hsa04611 )
- Circadian entrainment (hsa04713 )
- Long-term potentiation (hsa04720 )
- Retrograde endocannabinoid signaling (hsa04723 )
- Glutamatergic synapse (hsa04724 )
- Cholinergic synapse (hsa04725 )
- Serotonergic synapse (hsa04726 )
- Dopaminergic synapse (hsa04728 )
- Long-term depression (hsa04730 )
- Inflammatory mediator regulation of TRP channels (hsa04750 )
- Insulin secretion (hsa04911 )
- GnRH signaling pathway (hsa04912 )
- Estrogen signaling pathway (hsa04915 )
- Melanogenesis (hsa04916 )
- Thyroid hormone synthesis (hsa04918 )
- Oxytocin signaling pathway (hsa04921 )
- Glucagon signaling pathway (hsa04922 )
- Renin secretion (hsa04924 )
- Aldosterone synthesis and secretion (hsa04925 )
- Cortisol synthesis and secretion (hsa04927 )
- Parathyroid hormone synthesis, secretion and action (hsa04928 )
- GnRH secretion (hsa04929 )
- Cushing syndrome (hsa04934 )
- Growth hormone synthesis, secretion and action (hsa04935 )
- Endocrine and other factor-regulated calcium reabsorption (hsa04961 )
- Salivary secretion (hsa04970 )
- Gastric acid secretion (hsa04971 )
- Pancreatic secretion (hsa04972 )
- Alzheimer disease (hsa05010 )
- Huntington disease (hsa05016 )
- Spinocerebellar ataxia (hsa05017 )
- Pathways of neurodegeneration - multiple diseases (hsa05022 )
- Yersinia infection (hsa05135 )
- Chagas disease (hsa05142 )
- African trypanosomiasis (hsa05143 )
- Amoebiasis (hsa05146 )
- Human cytomegalovirus infection (hsa05163 )
- Human immunodeficiency virus 1 infection (hsa05170 )
- Pathways in cancer (hsa05200 )
|
| Reactome Pathway |
- G-protein activation (R-HSA-202040 )
- Acetylcholine regulates insulin secretion (R-HSA-399997 )
- G alpha (q) signalling events (R-HSA-416476 )
- ADP signalling through P2Y purinoceptor 1 (R-HSA-418592 )
- Thromboxane signalling through TP receptor (R-HSA-428930 )
- Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion (R-HSA-434316 )
- Thrombin signalling through proteinase activated receptors (PARs) (R-HSA-456926 )
- Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding (R-HSA-6814122 )
- PLC beta mediated events (R-HSA-112043 )
|
|
|
|
|
|
|
