Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTL2ADK)

• DTT Name: Rotamase A (PPIA)
• Synonyms: PPIA; Cyclophilin A; CyPA
• Gene Name: PPIA
• DTT Type: Successful target; [1]
• BioChemical Class: Cis-trans-isomerases
• UniProt ID: PPIA_HUMAN
• TTD ID: T47081
• EC Number: EC 5.2.1.8
• Sequence:
  MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
  MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
  WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
• Function: Ppiases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
• KEGG Pathway:
  Viral life cycle - HIV-1 (hsa03250)
  Necroptosis (hsa04217)
• Reactome Pathway:
  Uncoating of the HIV Virion (R-HSA-162585)
  Budding and maturation of HIV virion (R-HSA-162588)
  Integration of provirus (R-HSA-162592)
  Early Phase of HIV Life Cycle (R-HSA-162594)
  Minus-strand DNA synthesis (R-HSA-164516)
  Plus-strand DNA synthesis (R-HSA-164525)
  Binding and entry of HIV virion (R-HSA-173107)
  Assembly Of The HIV Virion (R-HSA-175474)
  APOBEC3G mediated resistance to HIV-1 infection (R-HSA-180689)
  Basigin interactions (R-HSA-210991)
  Platelet degranulation (R-HSA-114608)

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
L-Proline	DMKSTWR	Malnutrition	5B50-5B71	Approved	[1]

6 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(3r)-1-Acetyl-3-Methylpiperidine	DM49YTN	Discovery agent	N.A.	Investigative	[2]
1-(3-benzyloxy-pyridin-2-yl)-3-phenyl-urea	DMDZAVU	Discovery agent	N.A.	Investigative	[3]
3-[3-(3-benzyloxy-pyridin-2-yl)-ureido]-benzamide	DM60YGF	Discovery agent	N.A.	Investigative	[3]
4-[3-(3-benzyloxy-pyridin-2-yl)-ureido]-benzamide	DMOPRQ7	Discovery agent	N.A.	Investigative	[3]
7-AMINO-4-METHYL-CHROMEN-2-ONE	DMC8O3Z	Discovery agent	N.A.	Investigative	[4]
Ethyl Oxo(Piperidin-1-Yl)Acetate	DM9KF0H	Discovery agent	N.A.	Investigative	[4]

References

• [1] Mechanistic insight into the role of transition-state stabilization in cyclophilin A. J Am Chem Soc. 2009 Jan 14;131(1):147-52.
• [2] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [3] Structure-based design, synthesis, and biological evaluation of novel inhibitors of human cyclophilin A. J Med Chem. 2006 Feb 9;49(3):900-10.
• [4] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.