Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTL4H8N)

• DTT Name: Regenerating human pro-islet peptide (REG3A)
• Synonyms: Regenerating islet-derived protein III-alpha; Regenerating islet-derived protein 3-alpha 15 kDa form; Regenerating islet-derived protein 3-alpha; Reg III-alpha; REG3A; REG-3-alpha; Pancreatitis-associated protein 1; Human proislet peptide; Hepatointestinal pancreatic protein; HIP/PAP
• Gene Name: REG3A
• DTT Type: Clinical trial target; [1]
• UniProt ID: REG3A_HUMAN
• TTD ID: T92030
• Sequence:
  MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKS
  WTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGW
  EWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
• Function: Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.
• Reactome Pathway: Antimicrobial peptides (R-HSA-6803157)

Molecular Interaction Atlas (MIA) of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ALF-5755	DMUA0XC	Liver failure	DB99.7	Phase 2	[1]
HIP-2B	DM45MR0	Type-1/2 diabetes	5A10-5A11	Phase 1	[2]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Liver failure	DD91.0	Liver tissue	1.68E-02	-0.13	-0.87

References

• [1] HIP/PAP prevents excitotoxic neuronal death and promotes plasticity. Ann Clin Transl Neurol. 2014 October; 1(10): 739-754.
• [2] Hepatocarcinoma-intestine-pancreas/pancreatic associated protein (HIP/PAP) is expressed and secreted by proliferating ductules as well as by hepatocarcinoma and cholangiocarcinoma cells. Am J Pathol.1999 Nov;155(5):1525-33.