Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTLDX4N)

• DTT Name: Interleukin-22 (IL22)
• Synonyms: ZCYTO18; UNQ3099/PRO10096; Interleukin22; ILTIF; IL10related Tcellderivedinducible factor; IL-TIF; IL-22; IL-10-related T-cell-derived-inducible factor; Cytokine Zcyto18
• Gene Name: IL22
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Cytokine: interleukin
• UniProt ID: IL22_HUMAN
• TTD ID: T44682
• Sequence:
  MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLA
  KEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVP
  FLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
• Function: Cytokine that contributes to the inflammatory response in vivo.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  JAK-STAT signaling pathway (hsa04630)
  Th17 cell differentiation (hsa04659)
  Inflammatory bowel disease (hsa05321)
• Reactome Pathway: Interleukin-20 family signaling (R-HSA-8854691)

Molecular Interaction Atlas (MIA) of This DTT

4 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
F-652	DM9201K	Graft-versus-host disease	4B24	Phase 2	[2]
Fezakinumab	DMJX2P4	Psoriasis vulgaris	EA90	Phase 2	[1]
RG7880	DM452RF	Diabetic foot ulcer	BD54	Phase 2	[3]
ILV-095	DMQ01MP	Psoriasis vulgaris	EA90	Phase 1	[1]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Psoriasis	EA90	Skin	3.69E-03	0.07	0.23

References

• [1] Emerging Therapies for the Treatment of Psoriasis. Dermatol Ther (Heidelb) 2012 December; 2(1): 16.
• [2] An Open-Label, Dose-Escalation Study to Assess the Safety and Efficacy of IL-22 Agonist F-652 in Patients With Alcohol-associated Hepatitis. Hepatology. 2020 Aug;72(2):441-453.
• [3] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)