Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTLHGSF)

DTT Name	Interferon-alpha 5 (IFNA5)
Synonyms	LeIF G; Interferon alphaG; Interferon alpha61; Interferon alpha5; Interferon alpha-G; Interferon alpha-61; Interferon alpha-5; IFNalpha5; IFN-alpha-5
Gene Name	IFNA5
DTT Type	Clinical trial target	[1]
BioChemical Class	Cytokine: interferon
UniProt ID	IFNA5_HUMAN
TTD ID	T08156
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFG FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLE ACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSAN LQERLRRKE
Function	Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Produced by macrophages, IFN-alpha have antiviral activities.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) Regulation of autophagy (hsa04140 ) PI3K-Akt signaling pathway (hsa04151 ) Toll-like receptor signaling pathway (hsa04620 ) RIG-I-like receptor signaling pathway (hsa04622 ) Cytosolic DNA-sensing pathway (hsa04623 ) Jak-STAT signaling pathway (hsa04630 ) Natural killer cell mediated cytotoxicity (hsa04650 ) Tuberculosis (hsa05152 ) Hepatitis C (hsa05160 ) Hepatitis B (hsa05161 ) Measles (hsa05162 ) Influenza A (hsa05164 ) Herpes simplex infection (hsa05168 ) Autoimmune thyroid disease (hsa05320 )
Reactome Pathway	Regulation of IFNA signaling (R-HSA-912694 ) TRAF6 mediated IRF7 activation (R-HSA-933541 ) Factors involved in megakaryocyte development and platelet production (R-HSA-983231 ) Interferon alpha/beta signaling (R-HSA-909733 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Interferon alpha 5	DMMZSIB	Infectious disease	1A00-CA43.1	Phase 1/2	[1]
NAHE-001	DMU6MJ1	Hepatitis C virus infection	1E51.1	Phase 1/2	[1]
------------------------------------------------------------------------------------

References

1	Interferons and viral infections. Biofactors. 2009 Jan-Feb;35(1):14-20.