Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTLK1RW)
| DTT Name | C-X-C motif chemokine 1 (CXCL1) | ||||
|---|---|---|---|---|---|
| Synonyms |
SCYB1; Neutrophil-activating protein 3; NAP-3; Melanoma growth stimulatory activity; MGSA; Growth-regulated alpha protein; Growth regulated protein; GROA; GRO1; GRO-alpha(1-73); GRO-alpha; GRO-a protein; GRO
|
||||
| Gene Name | CXCL1 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Cytokine: CXC chemokine
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV
NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN |
||||
| Function |
May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity. Has chemotactic activity for neutrophils.
|
||||
| KEGG Pathway |
|
||||
| Reactome Pathway | |||||