Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTLONKX)

• DTT Name: PP2A B subunit isoform R5-alpha (PPP2R5A)
• Synonyms: Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform; Protein phosphatase-2A; PR61alpha; PP2A, B subunit, R5 alpha isoform; PP2A, B subunit, PR61 alpha isoform; PP2A, B subunit, B56 alpha isoform; PP2A, B subunit, B' alpha isoform; PP2A B subunit isoform PR61-alpha; PP2A B subunit isoform B56-alpha; PP2A B subunit isoform B'-alpha
• Gene Name: PPP2R5A
• DTT Type: Literature-reported target; [1]
• UniProt ID: 2A5A_HUMAN
• TTD ID: T57291
• Sequence:
  MSSSSPPAGAASAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQAELHPLPQLK
  DATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAY
  SDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIA
  KRYIDQKFVQQLLELFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYET
  EHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFL
  EKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLFKQISKCV
  SSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLYKISKEHWNPTIVALVYNVLK
  TLMEMNGKLFDDLTSSYKAERQREKKKELEREELWKKLEELKLKKALEKQNSAYNMHSIL
  SNTSAE
• Function: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
• KEGG Pathway:
  mRNA surveillance pathway (hsa03015)
  Sphingolipid signaling pathway (hsa04071)
  Oocyte meiosis (hsa04114)
  PI3K-Akt signaling pathway (hsa04151)
  AMPK signaling pathway (hsa04152)
  Adrenergic signaling in cardiomyocytes (hsa04261)
  Dopaminergic synapse (hsa04728)
• Reactome Pathway:
  Separation of Sister Chromatids (R-HSA-2467813)
  Resolution of Sister Chromatid Cohesion (R-HSA-2500257)
  CTLA4 inhibitory signaling (R-HSA-389513)
  Platelet sensitization by LDL (R-HSA-432142)
  Disassembly of the destruction complex and recruitment of AXIN to the membrane (R-HSA-4641262)
  S33 mutants of beta-catenin aren't phosphorylated (R-HSA-5358747)
  S37 mutants of beta-catenin aren't phosphorylated (R-HSA-5358749)
  S45 mutants of beta-catenin aren't phosphorylated (R-HSA-5358751)
  T41 mutants of beta-catenin aren't phosphorylated (R-HSA-5358752)
  RHO GTPases Activate Formins (R-HSA-5663220)
  RAF activation (R-HSA-5673000)
  Negative regulation of MAPK pathway (R-HSA-5675221)
  Mitotic Prometaphase (R-HSA-68877)
  Degradation of beta-catenin by the destruction complex (R-HSA-195253)

Molecular Interaction Atlas (MIA) of This DTT

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
NORCANTHARIDIN	DM9B6Y1	Discovery agent	N.A.	Investigative	[1]

References

• [1] Structure-activity relationship of cantharidin derivatives to protein phosphatases 1, 2A1, and 2B, Bioorg. Med. Chem. Lett. 7(14):1833-1836 (1997).