Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTLZK1U)
| DTT Name | Secondary lymphoid-tissue chemokine (CCL21) | ||||
|---|---|---|---|---|---|
| Synonyms | UNQ784/PRO1600; Small-inducible cytokine A21; SLC; SCYA21; C-C motif chemokine 21; Beta-chemokine exodus-2; 6Ckine | ||||
| Gene Name | CCL21 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Cytokine: CC chemokine
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIP
AILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSK GCKRTERSQTPKGP |
||||
| Function |
Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4. Inhibits hemopoiesis and stimulates chemotaxis.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||