Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTM7Y45)

DTT Name	Caspase-7 (CASP7)
Synonyms	MCH3; ICE-like apoptotic protease 3; ICE-LAP3; CMH-1; CASP-7; Apoptotic protease Mch-3
Gene Name	CASP7
DTT Type	Clinical trial target	[1]
BioChemical Class	Peptidase
UniProt ID	CASP7_HUMAN
TTD ID	T72252
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	EC 3.4.22.60
Sequence	MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQY NMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQ DLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELY FSQ
Function	Cleaves and activates sterol regulatory element binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-\|-Gly-217' bond. Overexpression promotes programmed cell death. Involved in the activation cascade of caspases responsible for apoptosis execution.
KEGG Pathway	Apoptosis (hsa04210 ) Apoptosis - multiple species (hsa04215 ) TNF signaling pathway (hsa04668 ) Non-alcoholic fatty liver disease (hsa04932 ) Alzheimer disease (hsa05010 ) Pathways of neurodegeneration - multiple diseases (hsa05022 ) Pathogenic Escherichia coli infection (hsa05130 ) Salmonella infection (hsa05132 ) Pertussis (hsa05133 ) Legionellosis (hsa05134 ) Pathways in cancer (hsa05200 ) Lipid and atherosclerosis (hsa05417 )
Reactome Pathway	SMAC (DIABLO) binds to IAPs (R-HSA-111463 ) SMAC(DIABLO)-mediated dissociation of IAP (R-HSA-111464 ) Apoptotic cleavage of cellular proteins (R-HSA-111465 ) SMAC, XIAP-regulated apoptotic response (R-HSA-111469 ) Caspase-mediated cleavage of cytoskeletal proteins (R-HSA-264870 ) Activation of caspases through apoptosome-mediated cleavage (R-HSA-111459 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
isatin sulfonamide 34	DM21Y8J	Cystic fibrosis	CA25	Clinical trial	[1]
------------------------------------------------------------------------------------

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
M826	DM9NPE4	Discovery agent	N.A.	Investigative	[2]
------------------------------------------------------------------------------------

References

1	Potent and selective nonpeptide inhibitors of caspases 3 and 7. J Med Chem. 2001 Jun 7;44(12):2015-26.
2	Novel pyrazinone mono-amides as potent and reversible caspase-3 inhibitors. Bioorg Med Chem Lett. 2005 Feb 15;15(4):1173-80.