Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTMA3VF)

• DTT Name: NCK adaptor protein 1 (NCK1)
• Synonyms: SH2/SH3 adaptor protein NCKalpha; SH2/SH3 adaptor protein NCK-alpha; Nck1; Nck-1; NCK; Cytoplasmic protein NCK1
• Gene Name: NCK1
• DTT Type: Clinical trial target; [1]
• UniProt ID: NCK1_HUMAN
• TTD ID: T70532
• Sequence:
  MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
  SARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
  REDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLA
  AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVG
  LVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
  HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
  IFTSEQGEKLYLVKHLS
• Function: Maintains low levels of EIF2S1 phosphorylation by promoting its dephosphorylation by PP1. Plays a role in the DNA damage response, not in the detection of the damage by ATM/ATR, but for efficient activation of downstream effectors, such as that of CHEK2. Plays a role in ELK1-dependent transcriptional activation in response to activated Ras signaling. Modulates the activation of EIF2AK2/PKR by dsRNA. May play a role in cell adhesion and migration through interaction with ephrin receptors. Adapter protein which associates with tyrosine-phosphorylated growth factor receptors, such as KDR and PDGFRB, or their cellular substrates.
• KEGG Pathway:
  ErbB signaling pathway (hsa04012)
  Axon guidance (hsa04360)
  T cell receptor signaling pathway (hsa04660)
  Pathogenic Escherichia coli infection (hsa05130)
• Reactome Pathway:
  Generation of second messenger molecules (R-HSA-202433)
  Regulation of actin dynamics for phagocytic cup formation (R-HSA-2029482)
  Nephrin family interactions (R-HSA-373753)
  DCC mediated attractive signaling (R-HSA-418885)
  Activation of RAC1 (R-HSA-428540)
  VEGFA-VEGFR2 Pathway (R-HSA-4420097)
  RHO GTPases Activate WASPs and WAVEs (R-HSA-5663213)
  RHOU GTPase cycle (R-HSA-9013420)
  RHOV GTPase cycle (R-HSA-9013424)
  FCGR3A-mediated phagocytosis (R-HSA-9664422)
  Antigen activates B Cell Receptor (BCR) leading to generation of second messengers (R-HSA-983695)
  Downstream signal transduction (R-HSA-186763)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AX-024	DMRQ32K	Multiple sclerosis	8A40	Phase 1	[1]

References

• [1] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)