Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTMG98T)

DTT Name	Heat shock protein 27 (HSP27)
Synonyms	Protein 3; HspB3; Heat shock protein beta3; Heat shock 17 kDa protein; HSP 17
Gene Name	HSPB3
DTT Type	Clinical trial target	[1]
BioChemical Class	Heat shock protein
UniProt ID	HSPB3_HUMAN
TTD ID	T68517
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MAKIILRHLIEIPVRYQEEFEARGLEDCRLDHALYALPGPTIVDLRKTRAAQSPPVDSAA ETPPREGKSHFQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKL PDGVEIKDLSAVLCHDGILVVEVKDPVGTK
Function	Inhibitor of actin polymerization.

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
OGX-427	DMJTU8D	Bladder cancer	2C94	Phase 2	[1]
------------------------------------------------------------------------------------

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
NK-1001	DMZMQDN	Atrial fibrillation	BC81.3	Discontinued in Phase 2	[2]
------------------------------------------------------------------------------------

References

1	Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
2	Novel therapeutic targets in the management of atrial fibrillation. Am J Cardiovasc Drugs. 2014 Dec;14(6):403-21.