Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTMR0OP)

• DTT Name: Endothelin (EDN)
• Synonyms: Preproendothelin-2; PPET2; Endothelin-2; ET-2
• Gene Name: EDN2
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Endothelin/sarafotoxin
• UniProt ID: EDN2_HUMAN
• TTD ID: T48358
• Sequence:
  MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECV
  YFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGA
  VPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR
• Function: Endothelins are endothelium-derived vasoconstrictor peptides.
• KEGG Pathway:
  cAMP signaling pathway (hsa04024)
  Neuroactive ligand-receptor interaction (hsa04080)
  Vascular smooth muscle contraction (hsa04270)
  Renin secretion (hsa04924)
• Reactome Pathway:
  G alpha (q) signalling events (R-HSA-416476)
  Peptide ligand-binding receptors (R-HSA-375276)

References

• [1] Endothelin as a therapeutic target in the treatment of cardiovascular disease. Heart Dis. 2001 May-Jun;3(3):176-88.